C20orf112 Polyclonal antibody

• 

  WB analysis of mouse brain using 23746-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 23746-1-AP (C20orf112 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 23746-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 23746-1-AP (C20orf112 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C20orf112 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23746-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Nucleolar protein 4-like, NOL4L, C20orf113

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23746-1-AP targets C20orf112 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20690

  Product name: Recombinant human C20orf112 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-166 aa of BC065370

  Sequence: SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD

• Full Name: chromosome 20 open reading frame 112
• Calculated Molecular Weight: 436 aa, 47 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC065370
• Gene Symbol: C20orf112
• Gene ID (NCBI): 140688
• RRID: AB_2879315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96MY1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C20orf112 ,also termed as chromosome 20 open reading frame 112, is a 436 amino acid protein, which consists of a relatively hydrophobic N terminal region and two putative small coiled-coil domains. C20orf112 may likely involve in endocytosis pathway and normal brain development. It also is required to mediate the cell energy response. The function of C20orf112 is still non-known and mechanism is required to further study.