Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
23746-1-AP targets C20orf112 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20690 Product name: Recombinant human C20orf112 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-166 aa of BC065370 Sequence: SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD Predict reactive species |
Full Name | chromosome 20 open reading frame 112 |
Calculated Molecular Weight | 436 aa, 47 kDa |
Observed Molecular Weight | 43 kDa |
GenBank Accession Number | BC065370 |
Gene Symbol | C20orf112 |
Gene ID (NCBI) | 140688 |
RRID | AB_2879315 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q96MY1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C20orf112 ,also termed as chromosome 20 open reading frame 112, is a 436 amino acid protein, which consists of a relatively hydrophobic N terminal region and two putative small coiled-coil domains. C20orf112 may likely involve in endocytosis pathway and normal brain development. It also is required to mediate the cell energy response. The function of C20orf112 is still non-known and mechanism is required to further study.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C20orf112 antibody 23746-1-AP | Download protocol |
IHC protocol for C20orf112 antibody 23746-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |