Tested Applications
| Positive WB detected in | HeLa cells, COLO 320 cells, Caco-2 cells, HT-29 cells, A549 cells, MCF-7 cells, HSC-T6 cells, NIH/3T3 cells, PC-12 cells, HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67247-1-Ig targets TMEM230 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15080 Product name: Recombinant human C20orf30 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-120 aa of BC011990 Sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD Predict reactive species |
| Full Name | chromosome 20 open reading frame 30 |
| Calculated Molecular Weight | 183 aa, 20 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC011990 |
| Gene Symbol | TMEM230 |
| Gene ID (NCBI) | 29058 |
| RRID | AB_2882524 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96A57 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM230 antibody 67247-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













