Tested Applications
Positive WB detected in | HeLa cells, COLO 320 cells, Caco-2 cells, HT-29 cells, A549 cells, MCF-7 cells, HSC-T6 cells, NIH/3T3 cells, PC-12 cells, HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67247-1-Ig targets TMEM230 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
Tested Reactivity | Human, Mouse, Rat |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15080 Product name: Recombinant human C20orf30 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-120 aa of BC011990 Sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD Predict reactive species |
Full Name | chromosome 20 open reading frame 30 |
Calculated Molecular Weight | 183 aa, 20 kDa |
Observed Molecular Weight | 16 kDa |
GenBank Accession Number | BC011990 |
Gene Symbol | TMEM230 |
Gene ID (NCBI) | 29058 |
RRID | AB_2882524 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q96A57 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM230 antibody 67247-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |