TMEM230 Monoclonal antibody, PBS Only

• 

  WB analysis using 67247-1-Ig (same clone as 67247-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67247-1-Ig (TMEM230 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67247-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67247-1-Ig (same clone as 67247-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67247-1-Ig (C20orf30 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67247-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 67247-1-Ig (same clone as 67247-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67247-1-Ig (C20orf30 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67247-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Caco-2 using 67247-1-Ig (same clone as 67247-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 67247-1-Ig (C20orf30 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67247-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67247-1-Ig (same clone as 67247-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67247-1-Ig (C20orf30 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67247-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67247-1-Ig (same clone as 67247-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67247-1-Ig (C20orf30 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67247-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67247-1-Ig (same clone as 67247-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67247-1-Ig (C20orf30 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67247-1-PBS in a different storage buffer formulation.

TMEM230 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67247-1-PBS

Clone No.4D3A7

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

Synonyms

C20orf30, dJ1116H23.2.1, HSPC274, TMEM230, UNQ2432/PRO4992

---

Product Information

67247-1-PBS targets TMEM230 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15080

  Product name: Recombinant human C20orf30 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-120 aa of BC011990

  Sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD

• Full Name: chromosome 20 open reading frame 30
• Calculated Molecular Weight: 183 aa, 20 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC011990
• Gene Symbol: TMEM230
• Gene ID (NCBI): 29058
• RRID: AB_2882524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96A57
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.