Tested Applications
| Positive WB detected in | L02 cells, PC-3 cells, U-937 cells |
| Positive IHC detected in | human tonsillitis tissue, human lung tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 27 publications below |
| IHC | See 12 publications below |
| IF | See 13 publications below |
Product Information
21316-1-AP targets C5aR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15968 Product name: Recombinant human C5AR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 251-350 aa of BC008982 Sequence: FFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV Predict reactive species |
| Full Name | complement component 5a receptor 1 |
| Calculated Molecular Weight | 350 aa, 39 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC008982 |
| Gene Symbol | C5aR |
| Gene ID (NCBI) | 728 |
| RRID | AB_10733105 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21730 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C5aR, also named as CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production. The deduced sequence of C5aR contains 350 amino acids, giving a calculated molecular weight of 39 kDa. C5aR has an N-linked glycosylation site in the N-terminal extracellular domain. The apparent molecular weight of C5aR is about 40-52 kDa (PMID: 1847994; 9136907; 9136907; 2007135).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C5aR antibody 21316-1-AP | Download protocol |
| IHC protocol for C5aR antibody 21316-1-AP | Download protocol |
| WB protocol for C5aR antibody 21316-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Immunity Complement is a central mediator of radiotherapy-induced tumor-specific immunity and clinical response. | ||
Theranostics The hepatocyte-specifically expressed lnc-HSER alleviates hepatic fibrosis by inhibiting hepatocyte apoptosis and epithelial-mesenchymal transition. | ||
Front Immunol A novel hollow iron nanoparticle system loading PEG-Fe3O4 with C5a receptor antagonist for breast cancer treatment | ||
Sci Rep Nerve Growth Factor Secretion From Pulp Fibroblasts is Modulated by Complement C5a Receptor and Implied in Neurite Outgrowth. | ||
Sci Rep Cardiac Depression in Pigs after Multiple Trauma - Characterization of Posttraumatic Structural and Functional Alterations. | ||
Cell Signal The C5aR1 complement receptor: A novel immunomodulator of insulin action in skeletal muscle
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Muhammad (Verified Customer) (12-25-2022) | one of the important receptor of complement system and this antibody helped a lot in our study to examine its role in regenerative medicine.
|

















