• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated C5aR Polyclonal antibody

C5aR Polyclonal Antibody for IF/ICC
Cat No. CL488-21316

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

C5A, C5a R, C5AR, C5AR1, C5R1, CD88

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21316 targets C5aR in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15968

Product name: Recombinant human C5AR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 251-350 aa of BC008982

Sequence: FFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

Predict reactive species
Full Name complement component 5a receptor 1
Calculated Molecular Weight 350 aa, 39 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC008982
Gene Symbol C5aR
Gene ID (NCBI) 728
RRIDAB_3084051
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21730
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. The deduced sequence of C5aR contains 350 amino acids, giving a calculated molecular weight of 39 kDa. C5aR has an N-linked glycosylation site in the N-terminal extracellular domain. The apparent molecular weight of C5aR is about 40-52 kDa (PMID: 1847994; 9136907; 9136907; 2007135).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 C5aR antibody CL488-21316Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...