C6orf130 Polyclonal antibody

• 

  WB analysis of PC-3 using 25249-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25249-1-AP (C6orf130 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

C6orf130 Polyclonal Antibody for WB, ELISA

Cat No. 25249-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

OARD1, [Protein ADP-ribosylglutamate] hydrolase OARD1, ADP-ribose glycohydrolase OARD1, EC:3.2.2.-, EC:3.5.1.-

---

Tested Applications

• Positive WB detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

25249-1-AP targets C6orf130 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19382

  Product name: Recombinant human C6orf130 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-152 aa of BC011709

  Sequence: MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL

• Full Name: chromosome 6 open reading frame 130
• Calculated Molecular Weight: 152 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC011709
• Gene Symbol: C6orf130
• Gene ID (NCBI): 221443
• RRID: AB_2753118
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y530
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OARD1 (O-acetyl-ADP-ribose deacetylase 1), also known as TARG1 (Terminal ADP-ribose protein glycohydrolase 1) and C6orf130, is a ADP-ribose glycohydrolase that hydrolyzes ADP-ribose and acts on different substrates, such as proteins ADP-ribosylated on glutamate and O-acetyl-ADP-D-ribose (PMID: 21849506; 23474714; 23481255). The MW of this protein is 17 kDa, and this antibody specially recognises the 17 kDa protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Human	WB	Nucleic Acids Res; TARG1 protects against toxic DNA ADP-ribosylation.; Authors - Callum Tromans-Coia
human	WB	Cell Rep; The interplay of TARG1 and PARG protects against genomic instability; Authors - Joséphine Groslambert ; KO Validated
human	WB	Mol Cell; PARP enzyme de novo synthesis of protein-free poly(ADP-ribose); Authors - Marie-France Langelier

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lisa (Verified Customer) (09-17-2025)

Generally a good working antibody, but not outstanding

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000