• Featured Product
  • KD/KO Validated

C6orf182 Polyclonal antibody

C6orf182 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 24957-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, IF/ICC, ELISA

Centrosomal protein 57kDa-like protein 1, Centrosomal protein CEP57L1, Centrosomal protein of 57 kDa-related protein, Cep57 related protein, CEP57L1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse kidney tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 3 publications below

Product Information

24957-1-AP targets C6orf182 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.

Tested Reactivity human, mouse, monkey
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21054

Product name: Recombinant human C6orf182 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-64 aa of BC064365

Sequence: MDSELMHSIVGSYHKPPERVFVPSFTQNEPSQNCHPANLEVTSPKILHSPNSQALILALKTLQE

Predict reactive species
Full Name chromosome 6 open reading frame 182
Calculated Molecular Weight 460 aa, 54 kDa
Observed Molecular Weight 55-65 kda
GenBank Accession NumberBC064365
Gene Symbol C6orf182
Gene ID (NCBI) 285753
RRIDAB_2879821
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IYX8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C6orf182 also named as Centrosomal protein of 57 kDa related protein is a 460 amino-acid protein, which belongs to translokin family. C6orf182 as centrosomal protein may be required for microtubule attachment to centrosomes and localizes in the cytoplasm. The function of C6orf182 need to be further studied.

Protocols

Product Specific Protocols
IF protocol for C6orf182 antibody 24957-1-APDownload protocol
WB protocol for C6orf182 antibody 24957-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

EMBO J

Multimodal mechanisms of human centriole engagement and disengagement

Authors - Kei K Ito
humanIF

J Cell Biol

Cep57 and Cep57L1 maintain centriole engagement in interphase to ensure centriole duplication cycle.

Authors - Kei K Ito
humanIF

Science

The mechanism of acentrosomal spindle assembly in human oocytes

Authors - Tianyu Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jay (Verified Customer) (10-03-2019)

-Methanol Fixation- IF result of C6orf182 antibody shows that C6orf182 (Cep57l1) localizes to centrosome in mouse NIH3T3 cell line- C6orf182(red), Centrin(green; centrosome marker) and DAPI(blue;nucleus)

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse NIH3T3
C6orf182 Antibody Immunofluorescence, validation (1:100 dilution) in Mouse NIH3T3 (Cat no:24957-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...