Tested Applications
| Positive WB detected in | A549 cells, mouse kidney tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 4 publications below |
Product Information
24957-1-AP targets C6orf182 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.
| Tested Reactivity | human, mouse, monkey |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21054 Product name: Recombinant human C6orf182 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC064365 Sequence: MDSELMHSIVGSYHKPPERVFVPSFTQNEPSQNCHPANLEVTSPKILHSPNSQALILALKTLQE Predict reactive species |
| Full Name | chromosome 6 open reading frame 182 |
| Calculated Molecular Weight | 460 aa, 54 kDa |
| Observed Molecular Weight | 55-65 kda |
| GenBank Accession Number | BC064365 |
| Gene Symbol | C6orf182 |
| Gene ID (NCBI) | 285753 |
| RRID | AB_2879821 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IYX8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C6orf182 also named as Centrosomal protein of 57 kDa related protein is a 460 amino-acid protein, which belongs to translokin family. C6orf182 as centrosomal protein may be required for microtubule attachment to centrosomes and localizes in the cytoplasm. The function of C6orf182 need to be further studied.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C6orf182 antibody 24957-1-AP | Download protocol |
| WB protocol for C6orf182 antibody 24957-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun The DNA replication machinery transmits dual signals to prevent unscheduled licensing and execution of centrosome duplication | ||
J Cell Biol Cep57 and Cep57L1 maintain centriole engagement in interphase to ensure centriole duplication cycle. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jay (Verified Customer) (10-03-2019) | -Methanol Fixation- IF result of C6orf182 antibody shows that C6orf182 (Cep57l1) localizes to centrosome in mouse NIH3T3 cell line- C6orf182(red), Centrin(green; centrosome marker) and DAPI(blue;nucleus)
![]() |




