C6orf182 Polyclonal antibody, PBS Only

• 

  WB analysis using 24957-1-AP (same clone as 24957-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24957-1-AP (C6orf182 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24957-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24957-1-AP (same clone as 24957-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using C6orf182 antibody (24957-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24957-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C6orf182 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 24957-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Centrosomal protein 57kDa-like protein 1, Centrosomal protein CEP57L1, Centrosomal protein of 57 kDa-related protein, Cep57 related protein, CEP57L1

---

Product Information

24957-1-PBS targets C6orf182 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, monkey samples.

• Tested Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21054

  Product name: Recombinant human C6orf182 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-64 aa of BC064365

  Sequence: MDSELMHSIVGSYHKPPERVFVPSFTQNEPSQNCHPANLEVTSPKILHSPNSQALILALKTLQE

• Full Name: chromosome 6 open reading frame 182
• Calculated Molecular Weight: 460 aa, 54 kDa
• Observed Molecular Weight: 55-65 kda
• GenBank Accession Number: BC064365
• Gene Symbol: C6orf182
• Gene ID (NCBI): 285753
• RRID: AB_2879821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C6orf182 also named as Centrosomal protein of 57 kDa related protein is a 460 amino-acid protein, which belongs to translokin family. C6orf182 as centrosomal protein may be required for microtubule attachment to centrosomes and localizes in the cytoplasm. The function of C6orf182 need to be further studied.