MPIG6B Polyclonal antibody

• 

  WB analysis using 26131-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26131-1-AP (C6orf25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

MPIG6B Polyclonal Antibody for WB, ELISA

Cat No. 26131-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C6orf25, G6B, G6B-B, Megakaryocyte and platelet inhibitory receptor G6b, NG31

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26131-1-AP targets MPIG6B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23442

  Product name: Recombinant human C6orf25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC113719

  Sequence: MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKA

• Full Name: chromosome 6 open reading frame 25
• Observed Molecular Weight: 24-29 kDa
• GenBank Accession Number: BC113719
• Gene Symbol: C6orf25
• Gene ID (NCBI): 80739
• RRID: AB_3669524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95866
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C6orf25, also called G6B, is an inhibitory receptor expressed on the surface of platelets,and it acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production (PMID: 17311996; 12665801; 27743390). C6orf25 has seven isoforms. Isoform B is the only isoform to contain both a transmembrane region and 2 immunoreceptor tyrosine-based inhibitor motifs (ITIMs) and, thus, the only one which probably has a role of inhibitory receptor. Isoform A may be the activating counterpart of isoform B (PMID: 11544253).