Product Information
27225-1-PBS targets CACNA1E in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25944 Product name: Recombinant human CACNA1E protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 801-900 aa of NM_000721 Sequence: MEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG Predict reactive species |
Full Name | calcium channel, voltage-dependent, R type, alpha 1E subunit |
Calculated Molecular Weight | 262 kDa |
Observed Molecular Weight | 240 kDa |
GenBank Accession Number | NM_000721 |
Gene Symbol | CACNA1E |
Gene ID (NCBI) | 777 |
RRID | AB_2880808 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15878 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CACNA1E is a gene encoding the ion-conducting α1 subunit of R-type voltage-dependent calcium channels, genetic variability of CACNA1E is associated to risk of type 2 diabetes, insulin resistance and impaired insulin secretion in nondiabetic subjects.