Tested Applications
| Positive WB detected in | mouse brain tissue, mouse skeletal muscle tissue, mouse cerebellum tissue, rat brain tissue, pig brain tissue |
| Positive IHC detected in | human skeletal muscle tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
| IHC | See 2 publications below |
| IF | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
27453-1-AP targets CACNA2D1 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26190 Product name: Recombinant human CACNA2D1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-124 aa of NM_000722 Sequence: MEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVY Predict reactive species |
| Full Name | calcium channel, voltage-dependent, alpha 2/delta subunit 1 |
| Calculated Molecular Weight | 125 kDa |
| Observed Molecular Weight | 125 kDa |
| GenBank Accession Number | NM_000722 |
| Gene Symbol | CACNA2D1 |
| Gene ID (NCBI) | 781 |
| RRID | AB_2880874 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54289 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CACNA2D1 antibody 27453-1-AP | Download protocol |
| IHC protocol for CACNA2D1 antibody 27453-1-AP | Download protocol |
| WB protocol for CACNA2D1 antibody 27453-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Brain Behav Immun Microglial IL-10 and β-endorphin expression mediates gabapentinoids antineuropathic pain. | ||
Heliyon Cherry leaf decoction inhibits NMDAR expression and thereby ameliorates CUMS- induced depression-like behaviors through downregulation of α2δ-1 | ||
iScience Exercise training affects calcium ion transport by downregulating the CACNA2D1 protein to reduce hypertension-induced myocardial injury in mice | ||
J Gastroenterol CACNA2D1 regulates the progression and influences the microenvironment of colon cancer
| ||
Neurochem Res Scavenger Receptor Class B Type I Modulates Epileptic Seizures and Receptor α2δ-1 Expression | ||
J Proteome Res ChIP-seq and RNA-seq Reveal the Involvement of Histone Lactylation Modification in Gestational Diabetes Mellitus |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH MALLIKARJUNA (Verified Customer) (11-07-2025) | WORKS GOOD FOR WESTERN BLOT
|
FH Christian (Verified Customer) (11-19-2018) | 1:50 - labelled neurons of interest1:200 - labelled 3-4 neurons of interest1:1000 - labelled 1-2 neurons of interest
![]() |


















