Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, mouse skeletal muscle tissue, mouse cerebellum tissue, rat brain tissue, pig brain tissue |
| Positive IHC detected in | human skeletal muscle tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27453-1-AP targets CACNA2D1 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26190 Product name: Recombinant human CACNA2D1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-124 aa of NM_000722 Sequence: MEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVY Predict reactive species |
| Full Name | calcium channel, voltage-dependent, alpha 2/delta subunit 1 |
| Calculated Molecular Weight | 125 kDa |
| Observed Molecular Weight | 125-150 kDa |
| GenBank Accession Number | NM_000722 |
| Gene Symbol | CACNA2D1 |
| Gene ID (NCBI) | 781 |
| RRID | AB_2880874 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54289 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Voltage-dependent calcium channel subunit alpha-2/delta-1 (CACNA2D1) is an alpha-2/delta subunit of voltage-gated calcium channels. It regulates calcium current density and the activation/inactivation kinetics of calcium channels and plays an essential role in excitation-contraction coupling (PMID: 35293990).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CACNA2D1 antibody 27453-1-AP | Download protocol |
| IHC protocol for CACNA2D1 antibody 27453-1-AP | Download protocol |
| WB protocol for CACNA2D1 antibody 27453-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CACNA2D1 (α2δ-1) Rabbit mAb (Cat# 27453-1-AP) has 13 citations spanning journals including Cell Metabolism, Advanced Science, Phytomedicine, Brain, Behavior, and Immunity, Cells, Journal of Gastroenterology, iScience, Neurochemical Research, Journal of Proteome Research, Cell and Tissue Research, Heliyon, Ecotoxicology and Environmental Safety, and bioRxiv. Research fields cover glucose homeostasis, neuropathic pain, cardiac disease, cancer, epilepsy, depression, and membrane protein biogenesis.
| Species | Application | Title |
|---|---|---|
Cell Metab Hepatocyte-to-intestinal stem cell remote communication regulates blood glucose homeostasis. | ||
Adv Sci (Weinh) Pathophysiology-Directed Engineering of a Combination Nanoanalgesic for Neuropathic Pain | ||
Phytomedicine Fuling Wenxin formula treats "Qi-Yin deficiency" arrhythmia by regulating the dilated cardiomyopathy and adrenergic signaling pathway in cardiomyocytes | ||
Brain Behav Immun Microglial IL-10 and β-endorphin expression mediates gabapentinoids antineuropathic pain. | ||
Ecotoxicol Environ Saf Cigarette smoke triggers calcium overload in mouse hippocampal neurons via the ΔFOSB-CACNA2D1 axis to impair cognitive performance | ||
Cells Calcium-Related Genes Predicting Outcomes and Serving as Therapeutic Targets in Endometrial Cancer |
Reviews
What customers say
Both reviewers rated the product 4 stars. One confirmed reliable performance for Western Blot at 1:1000 dilution on liver tissue. The other tested it for immunohistochemistry and immunofluorescence on mouse spinal cord neurons, reporting clear, dose-dependent labeling: 1:50 highlighted many neurons, 1:200 labeled 3–4 neurons of interest, and 1:1000 detected 1–2 neurons. Overall, users report consistent specificity and strong signal across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-07-2025) | WORKS GOOD FOR WESTERN BLOT
|
Christian (Verified Customer) (11-19-2018) | 1:50 - labelled neurons of interest1:200 - labelled 3-4 neurons of interest1:1000 - labelled 1-2 neurons of interest
 |
