Tested Applications
Positive IF-P detected in | mouse eye tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-27453 targets CACNA2D1 in IF-P applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26190 Product name: Recombinant human CACNA2D1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-124 aa of NM_000722 Sequence: MEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVY Predict reactive species |
Full Name | calcium channel, voltage-dependent, alpha 2/delta subunit 1 |
Calculated Molecular Weight | 125 kDa |
Observed Molecular Weight | 125 kDa |
GenBank Accession Number | NM_000722 |
Gene Symbol | CACNA2D1 |
Gene ID (NCBI) | 781 |
RRID | AB_3672813 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P54289 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 CACNA2D1 antibody CL488-27453 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |