CALCA/Calcitonin Polyclonal antibody

• 

  WB analysis using 22244-1-AP

  TT cells were subjected to SDS PAGE followed by western blot with 22244-1-AP (CGRP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 22244-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 22244-1-AP (CGRP antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of TT using 22244-1-AP

  IP result of anti-CALCA/CGRP (IP:22244-1-AP, 4ug; Detection:22244-1-AP 1:600) with TT cells lysate 945 ug.

CALCA/Calcitonin Polyclonal Antibody for WB, IP, ELISA

Cat No. 22244-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

CALCA/CGRP, CALCA, Calcitonin, CALC1, Calcitonin gene-related peptide 1

---

Tested Applications

• Positive WB detected in: TT cells, Transfected HEK-293 cells
• Positive IP detected in: TT cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22244-1-AP targets CALCA/Calcitonin in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17737

  Product name: Recombinant human CALCA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-141 aa of BC093753

  Sequence: ELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN

• Full Name: Calcitonin
• Calculated Molecular Weight: 141 aa, 15 kDa
• Observed Molecular Weight: 14 kDa, 5 kDa
• GenBank Accession Number: BC093753
• Gene Symbol: CALCA
• Gene ID (NCBI): 796
• RRID: AB_3669393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01258
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calcitonin is a peptide hormone consisting of 32 amino acids, primarily synthesized by the parafollicular cells (C cells) of the human thyroid gland. It plays a crucial role in regulating calcium levels in the blood by decreasing them. Calcitonin opposes the actions of parathyroid hormone, which increases blood calcium levels. Calcitonin works through a G protein-coupled receptor, known as the calcitonin receptor, which predominantly transmits signals via the cAMP and PLC/IP3 pathways. Its primary physiological effects are on osteoclasts and the tubular epithelium of kidneys.