CALHM2 Polyclonal antibody

• 

  WB analysis using 19931-1-AP

  Mouse brain extracted membrane protein and total protein lysates were subjected to SDS PAGE followed by western blot with 19931-1-AP (CALHM2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 19931-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19931-1-AP (CALHM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 19931-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19931-1-AP (CALHM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 19931-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19931-1-AP (CALHM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 19931-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19931-1-AP (CALHM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 19931-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CALHM2 antibody (19931-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

CALHM2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 19931-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CALHM2, FAM26B, Protein FAM26B

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

19931-1-AP targets CALHM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13909

  Product name: Recombinant human CALHM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 206-323 aa of BC000039

  Sequence: KHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLAGNGAAPDNVEMALLPS

• Full Name: calcium homeostasis modulator 2
• Calculated Molecular Weight: 323 aa, 36 kDa
• Observed Molecular Weight: 32-36 kDa
• GenBank Accession Number: BC000039
• Gene Symbol: CALHM2
• Gene ID (NCBI): 51063
• RRID: AB_2878626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HA72
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALHM2, also named as FAM26B, is a pore-forming subunit of a voltage-gated ion channel. It's a critical ATP-releasing channel that modulates neural activity and as a potential risk factor of depression. There're three isoforms of CALHM2 with calculated MW 36 kDa, 24 kDa and 22 kDa. It's about 32-36 kDa in western blot with membrane protein extraceted lysate.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,rat	WB	Cereb Cortex; P2X7 receptor-mediated depression-like reactions arising in the mouse medial prefrontal cortex; Authors - Wen-Jing Ren
mouse	IF	Brain Res Bull; Upregulation of Calhm2 in the anterior cingulate cortex contributes to the maintenance of bilateral mechanical allodynia and comorbid anxiety symptoms in inflammatory pain conditions; Authors - Xiaohui Li