Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19931-1-AP targets CALHM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13909 Product name: Recombinant human CALHM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 206-323 aa of BC000039 Sequence: KHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLAGNGAAPDNVEMALLPS Predict reactive species |
| Full Name | calcium homeostasis modulator 2 |
| Calculated Molecular Weight | 323 aa, 36 kDa |
| Observed Molecular Weight | 32-36 kDa |
| GenBank Accession Number | BC000039 |
| Gene Symbol | CALHM2 |
| Gene ID (NCBI) | 51063 |
| RRID | AB_2878626 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HA72 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CALHM2, also named as FAM26B, is a pore-forming subunit of a voltage-gated ion channel. It's a critical ATP-releasing channel that modulates neural activity and as a potential risk factor of depression. There're three isoforms of CALHM2 with calculated MW 36 kDa, 24 kDa and 22 kDa. It's about 32-36 kDa in western blot with membrane protein extraceted lysate.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CALHM2 antibody 19931-1-AP | Download protocol |
| IHC protocol for CALHM2 antibody 19931-1-AP | Download protocol |
| WB protocol for CALHM2 antibody 19931-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CALHM2 Polyclonal antibody (Cat# 19931-1-AP) has 3 total citations. These appear in Brain Research Bulletin, Cerebral Cortex, and Journal of Chromatography B. The research fields span neuroscience and psychiatry, covering mechanical allodynia and comorbid anxiety in inflammatory pain, P2X7 receptor-mediated depression-like behavior, and neuroinflammation with synaptic plasticity in depression. Applications cited include Western blot and immunofluorescence, with species used being mouse and rat.
| Species | Application | Title |
|---|---|---|
Brain Res Bull Upregulation of Calhm2 in the anterior cingulate cortex contributes to the maintenance of bilateral mechanical allodynia and comorbid anxiety symptoms in inflammatory pain conditions | ||
Cereb Cortex P2X7 receptor-mediated depression-like reactions arising in the mouse medial prefrontal cortex | ||
J Chromatogr B Analyt Technol Biomed Life Sci A systems-level understanding of Radix Bupleuri-Radix Paeoniae Alba in depression: multi-omics reveals synergistic regulation of Neuroinflammation and synaptic plasticity. |
