Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
19931-1-AP targets CALHM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13909 Product name: Recombinant human CALHM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 206-323 aa of BC000039 Sequence: KHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLAGNGAAPDNVEMALLPS Predict reactive species |
Full Name | calcium homeostasis modulator 2 |
Calculated Molecular Weight | 323 aa, 36 kDa |
Observed Molecular Weight | 32-36 kDa |
GenBank Accession Number | BC000039 |
Gene Symbol | CALHM2 |
Gene ID (NCBI) | 51063 |
RRID | AB_2878626 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9HA72 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CALHM2, also named as FAM26B, is a pore-forming subunit of a voltage-gated ion channel. It's a critical ATP-releasing channel that modulates neural activity and as a potential risk factor of depression. There're three isoforms of CALHM2 with calculated MW 36 kDa, 24 kDa and 22 kDa. It's about 32-36 kDa in western blot with membrane protein extraceted lysate.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CALHM2 antibody 19931-1-AP | Download protocol |
IHC protocol for CALHM2 antibody 19931-1-AP | Download protocol |
IF protocol for CALHM2 antibody 19931-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cereb Cortex P2X7 receptor-mediated depression-like reactions arising in the mouse medial prefrontal cortex | ||
Brain Res Bull Upregulation of Calhm2 in the anterior cingulate cortex contributes to the maintenance of bilateral mechanical allodynia and comorbid anxiety symptoms in inflammatory pain conditions |