Calmodulin Polyclonal antibody

Calmodulin Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 10541-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, FC (Intra), IP, CoIP, ELISA

CALM3, CALML2, Calmodulin 1/2/3, Calmodulin 3, CaM

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, HepG2 cells, mouse brain tissue, MCF-7 cells, HeLa cells, NCCIT cells, rat skeletal muscle tissue
Positive IP detected inRamos cells
Positive IHC detected inhuman breast cancer tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10541-1-AP targets Calmodulin in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0827

Product name: Recombinant human CALM3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC006182

Sequence: MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDESLSMPLISSFCPRLFHPCLPRPDAFIS

Predict reactive species
Full Name calmodulin 3 (phosphorylase kinase, delta)
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC006182
Gene Symbol Calmodulin 3
Gene ID (NCBI) 808
RRIDAB_2069442
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62158
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calmodulin (CaM) is a Ca(2+)-binding protein that transduces Ca2+-mediated signals by binding to and regulating the activity of hundreds of enzymes and non-enzymatic proteins. It is highly conserved across species and involved in many biological processes, including vesicle release, cell proliferation, and apoptosis. This antibody can recognize CALM1, CALM2 and CALM3.

Protocols

Product Specific Protocols
FC protocol for Calmodulin antibody 10541-1-APDownload protocol
IHC protocol for Calmodulin antibody 10541-1-APDownload protocol
IP protocol for Calmodulin antibody 10541-1-APDownload protocol
WB protocol for Calmodulin antibody 10541-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Commun

Stalled translation by mitochondrial stress upregulates a CNOT4-ZNF598 ribosomal quality control pathway important for tissue homeostasis

Authors - Ji Geng
humanWB

Nat Commun

Selectively targeting the AdipoR2-CaM-CaMKII-NOS3 axis by SCM-198 as a rapid-acting therapy for advanced acute liver failure

Authors - Rui Wang
human

Autophagy

Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy

Authors - Kui Wang
humanWB,IHC

Cancer Cell Int

CALM1 promotes progression and dampens chemosensitivity to EGFR inhibitor in esophageal squamous cell carcinoma.

Authors - Tao Liu
IP

Neurochem Int

Alpha-synuclein overexpression increases phospho-protein phosphatase 2A levels via formation of calmodulin/Src complex.

Authors - W Yang
humanWB

Biochem Biophys Res Commun

The NMDAR GluN1-1a C-terminus binds to CaM and regulates synaptic function.

Authors - Liang Zhou
Loading...
||
New chat

Able

正在加载,请稍候...