Tested Applications
| Positive WB detected in | human skeletal muscle tissue, pig skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue | 
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | U2OS cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below | 
| IHC | See 1 publications below | 
| IP | See 1 publications below | 
Product Information
67366-1-Ig targets CAPN3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag13179 Product name: Recombinant human CAPN3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-156 aa of BC004883 Sequence: MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA Predict reactive species | 
                                    
| Full Name | calpain 3, (p94) | 
| Calculated Molecular Weight | 18 kDa | 
| Observed Molecular Weight | 90-105 kDa, 55-60 kDa, 30-35 kDa | 
| GenBank Accession Number | BC004883 | 
| Gene Symbol | CAPN3 | 
| Gene ID (NCBI) | 825 | 
| RRID | AB_2882618 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P20807 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Calpain 3 (CAPN3), a major intracellular protease, is a muscle-specific member of the calpain large subunit family that specifically binds to titin. CAPN3 plays a role in the dysferlin protein complex and that disruption of CAPN3 function may affect muscle membrane repair and remodeling. CAPN3 has some isoforms with MW of 94, 84, 93, 36, 18 kDa. CAPN3 autolysis generates a small N-terminal fragment of 34 kDa and a large C-terminal fragment whose size ranges from 55 to 60 kDa during self-processing (PMID: 9794799, 14645524).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CAPN3 antibody 67366-1-Ig | Download protocol | 
| IHC protocol for CAPN3 antibody 67366-1-Ig | Download protocol | 
| WB protocol for CAPN3 antibody 67366-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 







