CAPZB Monoclonal antibody, PBS Only

• 

  WB analysis using 68190-1-Ig (same clone as 68190-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68190-1-Ig (CAPZB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 68190-1-Ig (same clone as 68190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68190-1-Ig (CAPZB antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68190-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 68190-1-Ig (same clone as 68190-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using CAPZB antibody (68190-1-Ig, Clone: 1F9G2 ) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68190-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 68190-1-Ig (same clone as 68190-1-PBS)

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human CAPZB (68190-1-Ig, Clone:1F9G2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68190-1-PBS in a different storage buffer formulation.

CAPZB Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 68190-1-PBS

Clone No.1F9G2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

1F9G2, CapZ beta, CapZbeta, F-actin-capping protein subunit beta

---

Product Information

68190-1-PBS targets CAPZB in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19373

  Product name: Recombinant human CAPZB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-243 aa of BC109241

  Sequence: SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL

• Full Name: capping protein (actin filament) muscle Z-line, beta
• Calculated Molecular Weight: 277 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC109241
• Gene Symbol: CAPZB
• Gene ID (NCBI): 832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P47756
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.