CAPZB Monoclonal antibody

• 

  WB analysis using 68190-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68190-1-Ig (CAPZB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control.

• 

  IHC staining of mouse testis using 68190-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68190-1-Ig (CAPZB antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 68190-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using CAPZB antibody (68190-1-Ig, Clone: 1F9G2 ) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of Jurkat using 68190-1-Ig

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human CAPZB (68190-1-Ig, Clone:1F9G2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CAPZB Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 68190-1-Ig

Clone No.1F9G2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

1F9G2, CapZ beta, CapZbeta, F-actin-capping protein subunit beta

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68190-1-Ig targets CAPZB in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19373

  Product name: Recombinant human CAPZB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-243 aa of BC109241

  Sequence: SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL

• Full Name: capping protein (actin filament) muscle Z-line, beta
• Calculated Molecular Weight: 277 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC109241
• Gene Symbol: CAPZB
• Gene ID (NCBI): 832
• RRID: AB_2935279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P47756
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.