• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CBS Monoclonal antibody

CBS Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67861
Clone No.1E4F10

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

EC:4.2.1.22, Cystathionine beta-synthase, cystathionine beta synthase, Beta-thionase, Beta thionase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67861 targets CBS in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7008

Product name: Recombinant human CBS protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 206-551 aa of BC000440

Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Predict reactive species
Full Name cystathionine-beta-synthase
Calculated Molecular Weight 61 kDa
Observed Molecular Weight 61-63 kDa
GenBank Accession NumberBC000440
Gene Symbol CBS
Gene ID (NCBI) 875
RRIDAB_2934577
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35520
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CBS antibody CL488-67861Download protocol
FC protocol for CL Plus 488 CBS antibody CL488-67861Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...