CBS Monoclonal antibody

• 

  WB analysis using 67861-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCI-H1299 using 67861-1-Ig

  WB result of CBS antibody (67861-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CBS transfected NCI-H1299 cells.

• 

  WB analysis of HEK-293 using 67861-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67861-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 67861-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 67861-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67861-1-Ig (CBS antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 67861-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67861-1-Ig (CBS antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67861-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CBS antibody (67861-1-Ig, Clone: 1E4F10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 67861-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CBS antibody (67861-1-Ig, Clone: 1E4F10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

CBS Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67861-1-Ig

Clone No.1E4F10

Publications(4)

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:4.2.1.22, Cystathionine beta-synthase, cystathionine beta synthase, Beta-thionase, Beta thionase

---

Tested Applications

• Positive WB detected in: LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, NCI-H1299 cells, HeLa cells, THP-1 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

67861-1-Ig targets CBS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7008

  Product name: Recombinant human CBS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 206-551 aa of BC000440

  Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

• Full Name: cystathionine-beta-synthase
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 61-63 kDa
• GenBank Accession Number: BC000440
• Gene Symbol: CBS
• Gene ID (NCBI): 875
• RRID: AB_2918619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35520
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Nanobiotechnology; NaHS@Cy5@MS@SP nanoparticles improve rheumatoid arthritis by inactivating the Hedgehog signaling pathway through sustained and targeted release of H2S into the synovium; Authors - Xue-Xue Zhu
rat	WB	FEBS J; Treatment with aripiprazole and N-acetylcysteine affects anaerobic cysteine metabolism in the hippocampus and reverses schizophrenia-like behavior in the neurodevelopmental rat model of schizophrenia; Authors - Magdalena Górny
rat	WB	Biomed Pharmacother; Hydrogen sulfide ameliorated preeclampsia via suppression of toll-like receptor 4-activated inflammation in the rostral ventrolateral medulla of rats.; Authors - Jiexian Du
		Nat Commun; In situ valence-transited arsenic nanosheets for multi-modal therapy of colorectal cancer; Authors - Hongyue Zheng