• Featured Product
  • KD/KO Validated

CBS Monoclonal antibody

CBS Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67861-1-Ig
Clone No.1E4F10

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

EC:4.2.1.22, Cystathionine beta-synthase, cystathionine beta synthase, Beta-thionase, Beta thionase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, NCI-H1299 cells, HeLa cells, THP-1 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

67861-1-Ig targets CBS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivitymouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7008

Product name: Recombinant human CBS protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 206-551 aa of BC000440

Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Predict reactive species
Full Name cystathionine-beta-synthase
Calculated Molecular Weight 61 kDa
Observed Molecular Weight 61-63 kDa
GenBank Accession NumberBC000440
Gene Symbol CBS
Gene ID (NCBI) 875
RRIDAB_2918619
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35520
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964).

Protocols

Product Specific Protocols
IF protocol for CBS antibody 67861-1-IgDownload protocol
IHC protocol for CBS antibody 67861-1-IgDownload protocol
WB protocol for CBS antibody 67861-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Nanobiotechnology

NaHS@Cy5@MS@SP nanoparticles improve rheumatoid arthritis by inactivating the Hedgehog signaling pathway through sustained and targeted release of H2S into the synovium

Authors - Xue-Xue Zhu
ratWB

FEBS J

Treatment with aripiprazole and N-acetylcysteine affects anaerobic cysteine metabolism in the hippocampus and reverses schizophrenia-like behavior in the neurodevelopmental rat model of schizophrenia

Authors - Magdalena Górny
ratWB

Biomed Pharmacother

Hydrogen sulfide ameliorated preeclampsia via suppression of toll-like receptor 4-activated inflammation in the rostral ventrolateral medulla of rats.

Authors - Jiexian Du

Nat Commun

In situ valence-transited arsenic nanosheets for multi-modal therapy of colorectal cancer

Authors - Hongyue Zheng
Loading...
||
New chat Able
正在加载,请稍候...