Tested Applications
Positive WB detected in | SH-SY5Y cells, Neuro-2a cells |
Positive IF/ICC detected in | U-251 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IF | See 5 publications below |
Product Information
24002-1-AP targets CEP89, CCDC123 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21206 Product name: Recombinant human CCDC123 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 248-343 aa of BC136328 Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE Predict reactive species |
Full Name | coiled-coil domain containing 123 |
Calculated Molecular Weight | 783 aa, 90 kDa |
Observed Molecular Weight | 85-100 kDa, 40 kDa |
GenBank Accession Number | BC136328 |
Gene Symbol | CEP89 |
Gene ID (NCBI) | 84902 |
RRID | AB_2879400 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96ST8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCDC123(as known as CEP123), also named as CEP89, is a new player in the process of primary ciliogenesis and it also plays a role in mitochondrial metabolism where it may modulate complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with Cep290(PMID:23575228, 23789104, 23348840). 24002-1-AP antibody recognizes all of CEP123 isoforms.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CEP89, CCDC123 antibody 24002-1-AP | Download protocol |
IF protocol for CEP89, CCDC123 antibody 24002-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Res NudCL2 is an autophagy receptor that mediates selective autophagic degradation of CP110 at mother centrioles to promote ciliogenesis. | ||
Dev Cell The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base. | ||
PLoS Biol The evolutionary conserved proteins CEP90, FOPNL, and OFD1 recruit centriolar distal appendage proteins to initiate their assembly | ||
Elife A hierarchical pathway for assembly of the distal appendages that organize primary cilia | ||
Elife Myristoylated Neuronal Calcium Sensor-1 captures the preciliary vesicle at distal appendages
|