CCDC21 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCDC21 Polyclonal antibody (26314-1-AP)

CCDC21 Polyclonal Antibody for WB, ELISA

Cat No. 26314-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IP, ELISA

Synonyms

CCDC21, CEP85

• 

  WB analysis of HeLa using 26314-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 26314-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 26314-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCDC21 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26314-1-AP targets CCDC21 in WB, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23636

  Product name: Recombinant human CCDC21 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 569-687 aa of BC064528

  Sequence: MESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAV

• Full Name: coiled-coil domain containing 21
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC064528
• Gene Symbol: CCDC21
• Gene ID (NCBI): 64793
• RRID: AB_2880475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P2H3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC21, also named as CEP85, is a Centrosomal protein with MW 85 kDa. All the isoforms of CCDC21 can be detected by this antibody.

Publications

What published studies show

The CCDC21 (CEP85) Polyclonal antibody (Cat# 26314-1-AP) has 3 citations published in Acta Pharmacol Sin, Cell Reports, and iScience. The research fields span pharmacology and drug toxicity mechanisms, membrane contact site protein identification, and centrosome biology including cell cycle regulation. All cited applications were WB, with IF and IP also used in one study.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Acta Pharmacol Sin; Comprehensive multi-omics analysis elucidates colchicine-induced toxicity mechanisms and unveils the therapeutic potential of MLN4924 and kinase inhibitors; Authors - Lin-Hui Zhai
	WB	Cell Rep; Human VAPome Analysis Reveals MOSPD1 and MOSPD3 as Membrane Contact Site Proteins Interacting with FFAT-Related FFNT Motifs.; Authors - Birol Cabukusta
human	WB,IF,IP	iScience; Cep85 Relays Plk1 Activity to Phosphorylated Nek2A for Its Timely Activation in Centrosome Disjunction.; Authors - Canhe Chen