CCDC21 Polyclonal antibody

CCDC21 Polyclonal Antibody for WB, ELISA
Cat No. 26314-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IP, ELISA

CCDC21, CEP85

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26314-1-AP targets CCDC21 in WB, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23636

Product name: Recombinant human CCDC21 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 569-687 aa of BC064528

Sequence: MESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAV

Predict reactive species
Full Name coiled-coil domain containing 21
Observed Molecular Weight 85-90 kDa
GenBank Accession NumberBC064528
Gene Symbol CCDC21
Gene ID (NCBI) 64793
RRIDAB_2880475
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6P2H3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC21, also named as CEP85, is a Centrosomal protein with MW 85 kDa. All the isoforms of CCDC21 can be detected by this antibody.

Protocols

Product Specific Protocols
WB protocol for CCDC21 antibody 26314-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF,IP

iScience

Cep85 Relays Plk1 Activity to Phosphorylated Nek2A for Its Timely Activation in Centrosome Disjunction.

Authors - Canhe Chen
WB

Cell Rep

Human VAPome Analysis Reveals MOSPD1 and MOSPD3 as Membrane Contact Site Proteins Interacting with FFAT-Related FFNT Motifs.

Authors - Birol Cabukusta
humanWB

Acta Pharmacol Sin

Comprehensive multi-omics analysis elucidates colchicine-induced toxicity mechanisms and unveils the therapeutic potential of MLN4924 and kinase inhibitors

Authors - Lin-Hui Zhai
Loading...
||
New chat Able
正在加载,请稍候...