CCDC21 Polyclonal antibody

CCDC21 Polyclonal Antibody for WB, ELISA

Cat No. 26314-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IP, ELISA

Synonyms

CCDC21, CEP85

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis of HeLa using 26314-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 26314-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 26314-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in

HeLa cells, Jurkat cells

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

26314-1-AP targets CCDC21 in WB, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23636 Product name: Recombinant human CCDC21 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 569-687 aa of BC064528 Sequence: MESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAV Predict reactive species
Full Name	coiled-coil domain containing 21
Observed Molecular Weight	85-90 kDa
GenBank Accession Number	BC064528
Gene Symbol	CCDC21
Gene ID (NCBI)	64793
RRID	AB_2880475
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q6P2H3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

CCDC21, also named as CEP85, is a Centrosomal protein with MW 85 kDa. All the isoforms of CCDC21 can be detected by this antibody.

Product Specific Protocols
WB protocol for CCDC21 antibody 26314-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
human	WB,IF,IP	iScience Cep85 Relays Plk1 Activity to Phosphorylated Nek2A for Its Timely Activation in Centrosome Disjunction. Authors - Canhe Chen View Article
	WB	Cell Rep Human VAPome Analysis Reveals MOSPD1 and MOSPD3 as Membrane Contact Site Proteins Interacting with FFAT-Related FFNT Motifs. Authors - Birol Cabukusta View Article
human	WB	Acta Pharmacol Sin Comprehensive multi-omics analysis elucidates colchicine-induced toxicity mechanisms and unveils the therapeutic potential of MLN4924 and kinase inhibitors Authors - Lin-Hui Zhai View Article