CCDC21 Polyclonal antibody

• 

  WB analysis of HeLa using 26314-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 26314-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 26314-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26314-1-AP (CCDC21 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

CCDC21 Polyclonal Antibody for WB, ELISA

Cat No. 26314-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IP, ELISA

Synonyms

CCDC21, CEP85

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

26314-1-AP targets CCDC21 in WB, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23636

  Product name: Recombinant human CCDC21 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 569-687 aa of BC064528

  Sequence: MESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAV

• Full Name: coiled-coil domain containing 21
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC064528
• Gene Symbol: CCDC21
• Gene ID (NCBI): 64793
• RRID: AB_2880475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P2H3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC21, also named as CEP85, is a Centrosomal protein with MW 85 kDa. All the isoforms of CCDC21 can be detected by this antibody.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,IP	iScience; Cep85 Relays Plk1 Activity to Phosphorylated Nek2A for Its Timely Activation in Centrosome Disjunction.; Authors - Canhe Chen
	WB	Cell Rep; Human VAPome Analysis Reveals MOSPD1 and MOSPD3 as Membrane Contact Site Proteins Interacting with FFAT-Related FFNT Motifs.; Authors - Birol Cabukusta
human	WB	Acta Pharmacol Sin; Comprehensive multi-omics analysis elucidates colchicine-induced toxicity mechanisms and unveils the therapeutic potential of MLN4924 and kinase inhibitors; Authors - Lin-Hui Zhai