CCL20/MIP-3 alpha Recombinant monoclonal antibody

• 

  WB analysis of HEK-293T using 86607-3-RR

  Non-transfected and rat CCL20-transfected HEK-293T cells were subjected to SDS PAGE followed by western blot with 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat liver using 86607-3-RR

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 86607-3-RR

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 86607-3-RR

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 86607-3-RR

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Transfected CHO-K1 using 86607-3-RR

  Immunofluorescent analysis of (4% PFA) fixed Transfected CHO-K1 using CCL20/MIP-3 alpha antibody (86607-3-RR, Clone: 250116E12 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

CCL20/MIP-3 alpha Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 86607-3-RR

Clone No.250116E12

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Beta-chemokine exodus-1, CC chemokine LARC, CC chemokine ST38, C-C motif chemokine 20, CCL 20

---

Tested Applications

• Positive WB detected in: Transfected with Rat CCL20/MIP-3 alpha HEK-293T cells
• Positive IHC detected in: rat liver tissue, rat colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Transfected CHO-K1

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86607-3-RR targets CCL20/MIP-3 alpha in WB, IHC, IF/ICC, ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3237

  Product name: Recombinant Rat CCL20/MIP-3 alpha protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-96 aa of NM_019233.1

  Sequence: SNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM

• Full Name: chemokine (C-C motif) ligand 20
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: NM_019233.1
• Gene Symbol: Ccl20
• Gene ID (NCBI): 29538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P97884
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.