Anti-Human CCL20/MIP-3 alpha Rabbit Recombinant Antibody

CCL20/MIP-3 alpha Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98221-1-RR
Clone No.241694B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

CCL20, MIP-3 Alpha, MIP-3α, 241694B2, Beta-chemokine exodus-1

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inPMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98221-1-RR targets CCL20/MIP-3 alpha in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2398

Product name: Recombinant Human CCL20/MIP-3 alpha protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 27-96 aa of NM_004591.3

Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Predict reactive species
Full Name chemokine (C-C motif) ligand 20
Calculated Molecular Weight11kDa
GenBank Accession NumberNM_004591.3
Gene Symbol CCL20/MIP-3 alpha
Gene ID (NCBI) 6364
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP78556-1
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.

Protocols

Product Specific Protocols
FC protocol for CCL20/MIP-3 alpha antibody 98221-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...