Mouse CCL5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87060-4-RR (same clone as 87060-4-PBS)

  LPS, PMA, and Brefeldin A-treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 87060-4-RR (CCL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87060-4-PBS in a different storage buffer formulation.

CCL5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87060-4-PBS

Clone No.250841C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

C-C motif chemokine 5, MuRantes, RANTES, Scya5, SIS-delta

---

Product Information

87060-4-PBS targets CCL5 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2253

  Product name: Recombinant Mouse CCL5 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-91 aa of Q5XZF2

  Sequence: SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

• Full Name: chemokine (C-C motif) ligand 5
• Calculated Molecular Weight: 10kd
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: Q5XZF2
• Gene Symbol: Ccl5
• Gene ID (NCBI): 20304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30882
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCL5 (C-C motif chemokine ligand 5), also known as RANTES, is a key inflammatory chemokine that attracts immune cells like T cells, monocytes, and eosinophils to sites of infection or inflammation, playing vital roles in immunity, viral defense (including HIV), and sometimes cancer progression, by binding to receptors like CCR1, CCR3, and CCR5 to signal cell movement and activation, with inhibitors being researched for therapeutic use.