CCL5 Recombinant monoclonal antibody

• 

  WB analysis using 87060-4-RR

  LPS, PMA, and Brefeldin A-treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 87060-4-RR (CCL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 87060-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87060-4-RR (CCL5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 87060-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87060-4-RR (CCL5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 87060-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 87060-4-RR (CCL5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 87060-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 87060-4-RR (CCL5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CCL5 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87060-4-RR

Clone No.250841C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

C-C motif chemokine 5, MuRantes, RANTES, Scya5, SIS-delta

---

Tested Applications

• Positive WB detected in: PMA, LPS and Brefeldin A treated RAW 264.7 cells
• Positive IHC detected in: mouse spleen tissue, mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87060-4-RR targets CCL5 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2253

  Product name: Recombinant Mouse CCL5 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-91 aa of Q5XZF2

  Sequence: SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

• Full Name: chemokine (C-C motif) ligand 5
• Calculated Molecular Weight: 10kd
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: Q5XZF2
• Gene Symbol: Ccl5
• Gene ID (NCBI): 20304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30882
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL5 (C-C motif chemokine ligand 5), also known as RANTES, is a key inflammatory chemokine that attracts immune cells like T cells, monocytes, and eosinophils to sites of infection or inflammation, playing vital roles in immunity, viral defense (including HIV), and sometimes cancer progression, by binding to receptors like CCR1, CCR3, and CCR5 to signal cell movement and activation, with inhibitors being researched for therapeutic use.