cyclin I Polyclonal antibody

• 

  WB analysis using 16357-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16357-1-AP (cyclin I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16357-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16357-1-AP (cyclin I antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 16357-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16357-1-AP (cyclin I antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat liver using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human brain using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

cyclin I Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16357-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CCNI, Cyclin-I

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat brain tissue
• Positive IHC detected in: mouse skeletal muscle tissue, human brain tissue, human liver tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16357-1-AP targets cyclin I in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0493

  Product name: Recombinant human CCNI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 259-377 aa of BC004975

  Sequence: VYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVSVM

• Full Name: cyclin I
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC004975
• Gene Symbol: CCNI
• Gene ID (NCBI): 10983
• RRID: AB_2275606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14094
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.