Tested Applications
Positive WB detected in | mouse brain tissue, human brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat brain tissue |
Positive IHC detected in | mouse skeletal muscle tissue, human brain tissue, human liver tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
16357-1-AP targets cyclin I in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0493 Product name: Recombinant human CCNI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 259-377 aa of BC004975 Sequence: VYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVSVM Predict reactive species |
Full Name | cyclin I |
Calculated Molecular Weight | 43 kDa |
Observed Molecular Weight | 43 kDa |
GenBank Accession Number | BC004975 |
Gene Symbol | CCNI |
Gene ID (NCBI) | 10983 |
RRID | AB_2275606 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q14094 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for cyclin I antibody 16357-1-AP | Download protocol |
IHC protocol for cyclin I antibody 16357-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |