cyclin I Polyclonal antibody

• Home
• Products
• Primary Antibodies
• cyclin I Polyclonal antibody (16357-1-AP)

cyclin I Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16357-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CCNI, Cyclin-I

• 

  WB analysis using 16357-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16357-1-AP (cyclin I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 16357-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16357-1-AP (cyclin I antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat skeletal muscle using 16357-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16357-1-AP (cyclin I antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16357-1-AP (cyclin I antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 16357-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16357-1-AP (cyclin I antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for cyclin I in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat brain tissue
• Positive IHC detected in: mouse skeletal muscle tissue, human brain tissue, human liver tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16357-1-AP targets cyclin I in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0493

  Product name: Recombinant human CCNI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 259-377 aa of BC004975

  Sequence: VYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVSVM

• Full Name: cyclin I
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC004975
• Gene Symbol: CCNI
• Gene ID (NCBI): 10983
• RRID: AB_2275606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14094
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The cyclin I Polyclonal antibody (Cat# 16357-1-AP) has a total of 1 citation. The citation appears in the Journal of Ethnopharmacology (2025), a study exploring the therapeutic effects and molecular mechanisms of total flavonoids of Abelmoschus manihot in treating IgA nephropathy using WGCNA analysis. The antibody was applied in IHC on rat samples. The associated research field is ethnopharmacology, specifically related to kidney disease (IgA nephropathy) treatment.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	J Ethnopharmacol; Exploring the therapeutic effects and molecular mechanisms of total flavonoids of Abelmoschus manihot (L.) Medic in the treatment of IgA nephropathy based on WGCNA; Authors - Changqing Wen