CCR3 Polyclonal antibody, PBS Only

• 

  IHC staining of human tonsillitis using 22351-1-AP (same clone as 22351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22351-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 22351-1-AP (same clone as 22351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22351-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 22351-1-AP (same clone as 22351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22351-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 22351-1-AP (same clone as 22351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22351-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22351-1-AP (same clone as 22351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22351-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22351-1-AP (same clone as 22351-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22351-1-PBS in a different storage buffer formulation.

CCR3 Polyclonal Antibody for IHC, ELISA

Cat No. 22351-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

---

Product Information

22351-1-PBS targets CCR3 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17926

  Product name: Recombinant human CCR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 310-354 aa of BC110297

  Sequence: KYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIV

• Full Name: chemokine (C-C motif) receptor 3
• Calculated Molecular Weight: 355 aa, 41 kDa
• GenBank Accession Number: BC110297
• Gene Symbol: CCR3
• Gene ID (NCBI): 1232
• RRID: AB_2879085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P51677
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.