Tested Applications
Positive WB detected in | U-937 cells, mouse thymus tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
82942-1-RR targets CCR5 in WB, ELISA applications and shows reactivity with Human, mouse samples.
Tested Reactivity | Human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag11493 Product name: Recombinant human CCR5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 257-352 aa of BC038398 Sequence: LNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL Predict reactive species |
Full Name | chemokine (C-C motif) receptor 5 |
Calculated Molecular Weight | 352 aa, 41 kDa |
Observed Molecular Weight | 45 kDa |
GenBank Accession Number | BC038398 |
Gene Symbol | CCR5 |
Gene ID (NCBI) | 1234 |
RRID | AB_3670685 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P51681 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCR5 (also known as CD195) is a member of the beta chemokine receptor family. This protein is expressed by T cells and macrophages and is known to be an important co-receptor for macrophage-tropic viruses, including HIV, to enter host cells. The natural chemokine ligands that bind to CCR5 include MIP-1-alpha, MIP-1-beta, MCP-2, and RANTES.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CCR5 antibody 82942-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |