CCR5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82942-1-RR (same clone as 82942-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82942-1-RR (CCR5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82942-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82942-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 82942-1-RR against Human CCR5 were performed. The affinity constant is 0.921 nM.

CCR5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82942-1-PBS

Clone No.230266A6

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, Indirect ELISA

Synonyms

C-C CKR-5, CC CKR 5, C-C chemokine receptor type 5, C C CKR 5, C C chemokine receptor type 5

---

Product Information

82942-1-PBS targets CCR5 in WB, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11493

  Product name: Recombinant human CCR5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 257-352 aa of BC038398

  Sequence: LNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

• Full Name: chemokine (C-C motif) receptor 5
• Calculated Molecular Weight: 352 aa, 41 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC038398
• Gene Symbol: CCR5
• Gene ID (NCBI): 1234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51681
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCR5 (also known as CD195) is a member of the beta chemokine receptor family. This protein is expressed by T cells and macrophages and is known to be an important co-receptor for macrophage-tropic viruses, including HIV, to enter host cells. The natural chemokine ligands that bind to CCR5 include MIP-1-alpha, MIP-1-beta, MCP-2, and RANTES.