Product Information
82942-1-PBS targets CCR5 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag11493 Product name: Recombinant human CCR5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 257-352 aa of BC038398 Sequence: LNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL Predict reactive species |
| Full Name | chemokine (C-C motif) receptor 5 |
| Calculated Molecular Weight | 352 aa, 41 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC038398 |
| Gene Symbol | CCR5 |
| Gene ID (NCBI) | 1234 |
| RRID | AB_3670685 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P51681 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CCR5 (also known as CD195) is a member of the beta chemokine receptor family. This protein is expressed by T cells and macrophages and is known to be an important co-receptor for macrophage-tropic viruses, including HIV, to enter host cells. The natural chemokine ligands that bind to CCR5 include MIP-1-alpha, MIP-1-beta, MCP-2, and RANTES.





