CCRL2 Monoclonal antibody, PBS Only

CCRL2 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66611-1-PBS
Clone No.2C1E11

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

C C chemokine receptor like 2, CCR11, CCR6, CCRL2, Chemokine receptor CCR11, Chemokine receptor X, CKRX, CRAM, CRAM A, CRAM B, HCR

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66611-1-PBS targets CCRL2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4045

Product name: Recombinant human CCRL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-344 aa of BC025717

Sequence: MWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Predict reactive species
Full Name chemokine (C-C motif) receptor-like 2
Calculated Molecular Weight 344 aa, 40 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC025717
Gene Symbol CCRL2
Gene ID (NCBI) 9034
RRIDAB_2881971
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO00421
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Chemokine CC motif receptor-like 2 (CCRL2) is a seven-transmembrane domain receptor that shares structural and functional similarities with the family of atypical chemokine receptors (ACKRs) (PMID: 28743719). CCRL2 does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. CCRL2 has been found on almost all hemopoietic cells, including monocytes, macrophages, polymorphonuclear neutrophils (PMNs), T cells, dendritic cells, natural killer cells, and CD34+ progenitor cells, with PMNs expressing the highest levels (PMID: 15188357). CCRL2 is also expressed by barrier cells, such as lymphatic and blood endothelial cells and bronchial and intestinal epithelial cells (PMID: 29056935).

Loading...
||
New chat Able
正在加载,请稍候...