CCRL2 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66611-1-Ig (same clone as 66611-1-PBS)

  HeLa cells and A431 cells were subjected to SDS PAGE followed by western blot with 66611-1-Ig (CCRL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66611-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 66611-1-Ig (same clone as 66611-1-PBS)

  A431 cells and K-562 cells were subjected to SDS PAGE followed by western blot with 66611-1-Ig (CCRL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66611-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 66611-1-Ig (same clone as 66611-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66611-1-Ig (CCRL2 antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66611-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 66611-1-Ig (same clone as 66611-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66611-1-Ig (CCRL2 antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66611-1-PBS in a different storage buffer formulation.

CCRL2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66611-1-PBS

Clone No.2C1E11

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

C C chemokine receptor like 2, CCR11, CCR6, CCRL2, Chemokine receptor CCR11, Chemokine receptor X, CKRX, CRAM, CRAM A, CRAM B, HCR

---

Product Information

66611-1-PBS targets CCRL2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4045

  Product name: Recombinant human CCRL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-344 aa of BC025717

  Sequence: MWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

• Full Name: chemokine (C-C motif) receptor-like 2
• Calculated Molecular Weight: 344 aa, 40 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC025717
• Gene Symbol: CCRL2
• Gene ID (NCBI): 9034
• RRID: AB_2881971
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00421
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chemokine CC motif receptor-like 2 (CCRL2) is a seven-transmembrane domain receptor that shares structural and functional similarities with the family of atypical chemokine receptors (ACKRs) (PMID: 28743719). CCRL2 does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. CCRL2 has been found on almost all hemopoietic cells, including monocytes, macrophages, polymorphonuclear neutrophils (PMNs), T cells, dendritic cells, natural killer cells, and CD34+ progenitor cells, with PMNs expressing the highest levels (PMID: 15188357). CCRL2 is also expressed by barrier cells, such as lymphatic and blood endothelial cells and bronchial and intestinal epithelial cells (PMID: 29056935).