Use Able AI chat for product recommendations

CCRL2 Monoclonal antibody

CCRL2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66611-1-Ig
Clone No. 2C1E11
Publications (5)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

C C chemokine receptor like 2, CCR11, CCR6, CCRL2, Chemokine receptor CCR11, Chemokine receptor X, CKRX, CRAM, CRAM A, CRAM B, HCR

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CCRL2 in ?

Tested Applications

Positive WB detected inHeLa cells, K-562 cells
Positive IHC detected inhuman spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66611-1-Ig targets CCRL2 in WB, IHC, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4045

Product name: Recombinant human CCRL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-344 aa of BC025717

Sequence: MWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Predict reactive species
Full Name chemokine (C-C motif) receptor-like 2
Calculated Molecular Weight 344 aa, 40 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC025717
Gene Symbol CCRL2
Gene ID (NCBI) 9034
RRIDAB_2881971
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO00421
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chemokine CC motif receptor-like 2 (CCRL2) is a seven-transmembrane domain receptor that shares structural and functional similarities with the family of atypical chemokine receptors (ACKRs) (PMID: 28743719). CCRL2 does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. CCRL2 has been found on almost all hemopoietic cells, including monocytes, macrophages, polymorphonuclear neutrophils (PMNs), T cells, dendritic cells, natural killer cells, and CD34+ progenitor cells, with PMNs expressing the highest levels (PMID: 15188357). CCRL2 is also expressed by barrier cells, such as lymphatic and blood endothelial cells and bronchial and intestinal epithelial cells (PMID: 29056935).

Protocols

Product Specific Protocols
IHC protocol for CCRL2 antibody 66611-1-IgDownload protocol
WB protocol for CCRL2 antibody 66611-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CCRL2 (Chemerin) recombinant Ig antibody (Cat# 66611-1-Ig) has 5 total citations. These appear in Hypertension, Frontiers in Immunology, PLoS Pathogens, and OncoTargets and Therapy. Research fields span preeclampsia and placental pathology, idiopathic pulmonary fibrosis, macrophage-driven anti-tumor immunity, viral SUMO-interaction in lymphoma, and breast cancer prognosis.

SpeciesApplicationTitle
humanWB

Hypertension

Statins Prevent the Deleterious Consequences of Placental Chemerin Upregulation in Preeclampsia

Authors - Lunbo Tan

Front Immunol

Macrophage NPM1 drives anti-tumor immunity via the STAT3-CCRL2 axis.

Authors - Lei Hong
humanWB

Front Immunol

Identification and validation of chemokine system-related genes in idiopathic pulmonary fibrosis

Authors - Tianming Zhao
humanWB

PLoS Pathog

Identification of viral SIM-SUMO2-interaction inhibitors for treating primary effusion lymphoma.

Authors - Ling Ding
humanWB

Onco Targets Ther

Oncogenic Role and Prognostic Value of MicroRNA-937-3p in Patients with Breast Cancer.

Authors - Deyu Li
Loading...
||
New chat

Able™

正在加载,请稍候...