Tested Applications
| Positive WB detected in | HeLa cells, K-562 cells |
| Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66611-1-Ig targets CCRL2 in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4045 Product name: Recombinant human CCRL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-344 aa of BC025717 Sequence: MWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV Predict reactive species |
| Full Name | chemokine (C-C motif) receptor-like 2 |
| Calculated Molecular Weight | 344 aa, 40 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC025717 |
| Gene Symbol | CCRL2 |
| Gene ID (NCBI) | 9034 |
| RRID | AB_2881971 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00421 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chemokine CC motif receptor-like 2 (CCRL2) is a seven-transmembrane domain receptor that shares structural and functional similarities with the family of atypical chemokine receptors (ACKRs) (PMID: 28743719). CCRL2 does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. CCRL2 has been found on almost all hemopoietic cells, including monocytes, macrophages, polymorphonuclear neutrophils (PMNs), T cells, dendritic cells, natural killer cells, and CD34+ progenitor cells, with PMNs expressing the highest levels (PMID: 15188357). CCRL2 is also expressed by barrier cells, such as lymphatic and blood endothelial cells and bronchial and intestinal epithelial cells (PMID: 29056935).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CCRL2 antibody 66611-1-Ig | Download protocol |
| WB protocol for CCRL2 antibody 66611-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CCRL2 (Chemerin) recombinant Ig antibody (Cat# 66611-1-Ig) has 5 total citations. These appear in Hypertension, Frontiers in Immunology, PLoS Pathogens, and OncoTargets and Therapy. Research fields span preeclampsia and placental pathology, idiopathic pulmonary fibrosis, macrophage-driven anti-tumor immunity, viral SUMO-interaction in lymphoma, and breast cancer prognosis.
| Species | Application | Title |
|---|---|---|
Hypertension Statins Prevent the Deleterious Consequences of Placental Chemerin Upregulation in Preeclampsia | ||
Front Immunol Identification and validation of chemokine system-related genes in idiopathic pulmonary fibrosis | ||
PLoS Pathog Identification of viral SIM-SUMO2-interaction inhibitors for treating primary effusion lymphoma. | ||
Onco Targets Ther Oncogenic Role and Prognostic Value of MicroRNA-937-3p in Patients with Breast Cancer. |







