Product Information
66582-1-PBS targets CD100 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26461 Product name: Recombinant human CD100 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 756-862 aa of BC054500 Sequence: YKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD Predict reactive species |
| Full Name | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
| Calculated Molecular Weight | 96 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC054500 |
| Gene Symbol | SEMA4D/CD100 |
| Gene ID (NCBI) | 10507 |
| RRID | AB_2881942 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92854 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD100 (also known as SEMA4D), a 150 kDa homodimer, belongs to the family of immune semaphorins, and CD100 is abundantly expressed on resting T cells, NK cells, and antigen-presenting cells. As a transmembrane glycoprotein, it is digested to its soluble form, sCD100, by specific matrix metalloproteinases. CD100 has been reported that the expression levels of CD100, and one of its receptors, plexin-B1 (PLXNB1), are increased in head and neck, prostate, colon, breast, and lung cancers, and the interaction between them provides oncogenic signaling essential for tumor growth and metastasis.



















