Product Information
66666-1-PBS targets CD133 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13327 Product name: Recombinant human CD133 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 505-782 aa of BC012089 Sequence: LICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPL Predict reactive species |
| Full Name | prominin 1 |
| Calculated Molecular Weight | 97 kDa |
| Observed Molecular Weight | 115 kDa, 80-90 kDa |
| GenBank Accession Number | BC012089 |
| Gene Symbol | CD133 |
| Gene ID (NCBI) | 8842 |
| RRID | AB_2801586 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O43490 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. CD133 is a highly glycosylated protein with an apparent molecular weight of 115-120 kDa. After the treatment of the lysates with glycosidase, CD133 shifted to a protein with an apparent molecular weight of 80-90 kDa (PMID: 23150174; 20068153).



















