Anti-Human CD179b Rabbit Recombinant Antibody

• 

  FC experiment of NALM-6 using 98738-2-RR

  1x10^6 NALM-6 cells (left) or REH cells (right) were surface stained with 0.25 ug Anti-Human CD179b Rabbit RecAb (98738-2-RR, Clone: 252001D6) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed.

CD179b Uni-rAb^® Recombinant Antibody for FC

Cat No. 98738-2-RR

Clone No.252001D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

IGLL1, CD179 antigen-like family member B, Ig lambda 5, Ig lambda-5, IGL1

---

Tested Applications

• Positive FC detected in: NALM-6 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98738-2-RR targets CD179b in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3515

  Product name: recombinant human IGLL1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 38-213 aa of BC012293

  Sequence: LLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS

• Full Name: immunoglobulin lambda-like polypeptide 1
• Calculated Molecular Weight: 213 aa, 23 kDa
• GenBank Accession Number: BC012293
• Gene Symbol: IGLL1
• Gene ID (NCBI): 3543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15814
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD179b, also known as IGLL1, VpreB (surrogate light chain, VpreB1), is a crucial protein component of the pre-B cell receptor (pre-BCR), which is essential for the early development of B lymphocytes (B cells) in the bone marrow.