Product Information
68700-1-PBS targets CD200 as part of a matched antibody pair:
MP50062-1: 68700-1-PBS capture and 68700-2-PBS detection (validated in Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Eg0006 Product name: Recombinant Human CD200 protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 31-232 aa of BC022522 Sequence: QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG Predict reactive species |
| Full Name | CD200 molecule |
| Calculated Molecular Weight | 269 aa, 30 kDa |
| GenBank Accession Number | BC022522 |
| Gene Symbol | CD200 |
| Gene ID (NCBI) | 4345 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P41217 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



