CD200 Monoclonal antibody, PBS Only (Detector)

CD200 Monoclonal Antibody for Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 68700-2-PBS
Clone No.1A1B5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

CD200 molecule, MOX1, MOX2, MRC, OX 2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68700-2-PBS targets CD200 as part of a matched antibody pair:

MP50062-1: 68700-1-PBS capture and 68700-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Affinity
KD=5.90 x 10-8M
KOff=5.13 x 10-3M
KOn=8.70 x 104M
Immunogen

CatNo: Eg0006

Product name: Recombinant Human CD200 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 31-232 aa of BC022522

Sequence: QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG

Predict reactive species
Full Name CD200 molecule
Calculated Molecular Weight 269 aa, 30 kDa
GenBank Accession NumberBC022522
Gene Symbol CD200
Gene ID (NCBI) 4345
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41217
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...