Tested Applications
Positive WB detected in | Daudi cells, mouse brain tissue, rat spleen tissue, Jurkat cells, MCF-7 cells, Raji cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 7 publications below |
IF | See 2 publications below |
Product Information
10600-1-AP targets CD24 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0654 Product name: Recombinant human CD24 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species |
Full Name | CD24 molecule |
Calculated Molecular Weight | 8 kDa |
Observed Molecular Weight | 30-70 kDa |
GenBank Accession Number | BC007674 |
Gene Symbol | CD24 |
Gene ID (NCBI) | 100133941 |
RRID | AB_10646440 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25063 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD24 antibody 10600-1-AP | Download protocol |
IHC protocol for CD24 antibody 10600-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Neuroinflammation Coding transcriptome analyses reveal altered functions underlying immunotolerance of PEG-fused rat sciatic nerve allografts. | ||
Int J Mol Sci Preclinical Repurposing of Sitagliptin as a Drug Candidate for Colorectal Cancer by Targeting CD24/CTNNB1/SOX4-Centered Signaling Hub | ||
Thyroid Clinical and Molecular Characterizations of Papillary Thyroid Cancer in Children and Young Adults: a Multicenter Retrospective Study. | ||
J Cell Mol Med LIPH promotes metastasis by enriching stem-like cells in triple-negative breast cancer. | ||
Stem Cells Int Nucleus Pulposus Cell Conditioned Medium Promotes Mesenchymal Stem Cell Differentiation into Nucleus Pulposus-Like Cells under Hypoxic Conditions. | ||
Adv Sci (Weinh) A Novel Long Non-Coding RNA lnc030 Maintains Breast Cancer Stem Cell Stemness by Stabilizing SQLE mRNA and Increasing Cholesterol Synthesis. |