CD24 Polyclonal antibody, PBS Only

• 

  WB analysis using 10600-1-AP (same clone as 10600-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10600-1-AP (CD24 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10600-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 10600-1-AP (same clone as 10600-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10600-1-AP (CD24 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10600-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat spleen using 10600-1-AP (same clone as 10600-1-PBS)

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 10600-1-AP (CD24 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10600-1-PBS in a different storage buffer formulation.

CD24 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10600-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CD24A

---

Product Information

10600-1-PBS targets CD24 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0654

  Product name: Recombinant human CD24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC007674

  Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

• Full Name: CD24 molecule
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 30-70 kDa
• GenBank Accession Number: BC007674
• Gene Symbol: CD24
• Gene ID (NCBI): 100133941
• RRID: AB_10646440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25063
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009)