Product Information
10600-1-PBS targets CD24 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0654 Product name: Recombinant human CD24 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species |
Full Name | CD24 molecule |
Calculated Molecular Weight | 8 kDa |
Observed Molecular Weight | 30-70 kDa |
GenBank Accession Number | BC007674 |
Gene Symbol | CD24 |
Gene ID (NCBI) | 100133941 |
RRID | AB_10646440 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25063 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009)