CD24 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CD24 Monoclonal antibody (67627-1-Ig)

CD24 Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67627-1-Ig Copied!

Clone No. 1H5C4

Publications (10)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

1H5C4, CD24A

• 

  WB analysis using 67627-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67627-1-Ig (CD24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Daudi using 67627-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Daudi cells using CD24 antibody (67627-1-Ig, Clone: 1H5C4 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Ramos using 67627-1-Ig

  1x10^6 Ramos cells were intracellularly stained with 0.25 ug CD24 Monoclonal antibody (67627-1-Ig, Clone:1H5C4) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD24 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, Raji cells, Ramos cells, Daudi cells, Jurkat cells, K-562 cells, HL-60 cells
• Positive IF/ICC detected in: Daudi cells
• Positive FC (Intra) detected in: Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67627-1-Ig targets CD24 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11679

  Product name: Recombinant human CD24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-80 aa of BC007674

  Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

• Full Name: CD24 molecule
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC007674
• Gene Symbol: CD24
• Gene ID (NCBI): 100133941
• RRID: AB_2882828
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P25063
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009)

Publications

What published studies show

CD24 Antibody (Cat# 67627-1-Ig) has 10 total citations published in journals including Experimental Molecular Medicine, Acta Pharmaceutica Sinica B, Advanced Science, Oncogene, Biochemical Pharmacology, World Journal of Stem Cells, Biomedicines, Parasites & Vectors, and Breast Cancer. Research fields encompass cancer stemness, Wnt signaling, tumor metastasis and dissemination, drug resistance, targeted protein degradation, antitumor immunity, hepatocarcinogenesis, and immunotherapy across breast, ovarian, gastric, and adrenocortical cancers.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Exp Mol Med; (Non)canonical Wnt signaling, cytoarchitecture and stemness: new insights from primary nonmetastatic, primary metastatic, regional and distant metastatic models of adrenocortical carcinoma.; Authors - Igor Shapiro
human	IHC	Acta Pharm Sin B; Anti-CD24 antibody-nitric oxide donor conjugates bearing a self-bioorthogonal cleavable linker.; Authors - Jianbing Wu
		Adv Sci (Weinh); Mechanoadaptation via Myosin Cytoplasmic Redistribution Protects Circulating Tumor Cells From Shear-induced Death During Hematogenous Dissemination; Authors - Cunyu Zhang
human	WB	Oncogene; A positive feedback loop of OTUD1 and c-Jun driven by leptin expedites stemness maintenance in ovarian cancer; Authors - Jingtao Wang
		Int J Biol Macromol; CD24 overexpression confers resistance to Pyrotinib through inhibiting autophagy in patients with HER2-positive breast cancer.; Authors - Yue Gao
		Biochem Pharmacol; Targeted degradation of CD24 by a transferrin receptor-engaging bispecific degrader enhances antitumor immunity.; Authors - Maorong Zhu