CoraLite®594-conjugated CD24 Monoclonal antibody

• 

  IF Staining of Daudi using CL594-67627

  Immunofluorescent analysis of (4% PFA) fixed Daudi cells using CoraLite®594 CD24 antibody (CL594-67627, Clone: 1H5C4 ) at dilution of 1:200.

CD24 Monoclonal Antibody for IF/ICC

Cat No. CL594-67627

Clone No.1H5C4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Synonyms

CD24A, 1H5C4

---

Tested Applications

• Positive IF/ICC detected in: Daudi cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67627 targets CD24 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11679

  Product name: Recombinant human CD24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-80 aa of BC007674

  Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

• Full Name: CD24 molecule
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC007674
• Gene Symbol: CD24
• Gene ID (NCBI): 100133941
• RRID: AB_2920165
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P25063
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009)