• Featured Product
  • KD/KO Validated

CD3 Monoclonal antibody, PBS Only (Detector)

CD3 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 60181-1-PBS
Clone No.3F3A1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

CD3E, 3F3A1, CD3 epsilon, CD3-epsilon, T3E

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60181-1-PBS targets CD3 as part of a matched antibody pair:

MP50222-1: 60181-2-PBS capture and 60181-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11797

Product name: Recombinant human CD3E protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-207 aa of BC049847

Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Predict reactive species
Full Name CD3e molecule, epsilon (CD3-TCR complex)
Calculated Molecular Weight 207 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC049847
Gene Symbol CD3
Gene ID (NCBI) 916
ENSEMBL Gene IDENSG00000198851
RRIDAB_10859262
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07766
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a monoclonal antibody directed against the epsilon chain of human CD3 molecule.

Loading...
||
New chat

Able

正在加载,请稍候...