Tested Applications
| Positive WB detected in | MOLT-4 cells, Jurkat cells, human PBMCs |
| Positive IHC detected in | human tonsillitis tissue, human breast cancer tissue, human colon tissue, human tonsillitis tissue, human appendicitis tissue, human liver tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:3200-1:12800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60181-1-Ig targets CD3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11797 Product name: Recombinant human CD3E protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-207 aa of BC049847 Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Predict reactive species |
| Full Name | CD3e molecule, epsilon (CD3-TCR complex) |
| Calculated Molecular Weight | 207 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC049847 |
| Gene Symbol | CD3 |
| Gene ID (NCBI) | 916 |
| ENSEMBL Gene ID | ENSG00000198851 |
| RRID | AB_10859262 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07766 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a monoclonal antibody directed against the epsilon chain of human CD3 molecule.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD3 antibody 60181-1-Ig | Download protocol |
| IHC protocol for CD3 antibody 60181-1-Ig | Download protocol |
| WB protocol for CD3 antibody 60181-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD3 Monoclonal antibody (3F3A1), catalog number 60181-1-Ig, has 67 citations published across journals including Autophagy, Hepatology, Dev Cell, Cancer Lett, J Immunother Cancer, EBioMedicine, Cell Death Discov, Pharmacol Res, Sci Signal, and Front Immunol, among others. Research fields span cancer immunology and immunotherapy, T cell biology, tumor microenvironment characterization, autoimmune and inflammatory diseases, fibrosis, and neurology. Cited applications are primarily IHC, IF, and WB.
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies | ||
Autophagy Autophagy loss impedes cancer-associated fibroblast activation via downregulating proline biosynthesis. | ||
Hepatology Hepatocyte-derived MASP1-enriched small extracellular vesicles activate HSCs to promote liver fibrosis | ||
MedComm (2020) Yin Yang 1 Promotes Antiprogrammed Cell Death-1 Resistance in Hepatocellular Carcinoma through Polypeptide N-Acetylgalactosaminyltransferase 16-Mediated Glycosylation of Programmed Death Ligand-1. | ||
Carbohydr Polym Multifunctional chitin-based hollow nerve conduit for peripheral nerve regeneration and neuroma inhibition. | ||
Pharmacol Res CX-5461 is a potent immunosuppressant which inhibits T cell-mediated alloimmunity via p53-DUSP5. |
Reviews
What customers say
There is currently one user review for this product. The reviewer, Maelle Picard, used the antibody (Lot 10023341) for immunohistochemistry on breast cancer tissue with immune infiltrate and rated it 2 out of 5, noting "very low signal." No image was provided, and the dilution used was listed as 1.50. Overall, the single review suggests suboptimal performance in IHC applications, though a broader assessment would require more user feedback.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maelle (Verified Customer) (01-03-2025) | Very low signal
|
