Anti-Human CD336 Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using 98371-1-RR

  1x10^6 HEK-293T cells or CD336 Transfected HEK-293T cells were stained with 0.25 ug Anti-Human CD336 Rabbit RecAb (98371-1-RR, Clone:242228B9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of Transfected HEK-293T using 98371-1-RR

  1x10^6 HEK-293T cells or CD336 Transfected HEK-293T cells were stained with 0.25 ug Anti-Human CD336 Rabbit RecAb (98371-1-RR, Clone:242228B9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CD336 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98371-1-RR

Clone No.242228B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

NCR2, LY95, Lymphocyte antigen 95 homolog, Natural killer cell p44-related protein, NK cell activating receptor

---

Tested Applications

• Positive FC detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98371-1-RR targets CD336 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1594

  Product name: Recombinant Human CD336 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-190 aa of NM_004828

  Sequence: QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

• Full Name: natural cytotoxicity triggering receptor 2
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_004828
• Gene Symbol: CD336
• Gene ID (NCBI): 9436
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95944
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD336, also named as NCR2, LY95 and NKp44, belongs to the natural cytotoxicity receptor (NCR) family. It is cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. It is expressed on activated human NK cells. CD336 displays a single extracellular Ig-like V domain and a transmembrane portion containing the charged residue (Lysine), likely involved in the association with KARAP/DAP12 molecules. The antibody is specific to CD336.