Anti-Human CD336 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Transfected HEK-293T using 98371-1-RR (same clone as 98371-1-PBS)

  1x10^6 HEK-293T cells or CD336 Transfected HEK-293T cells were stained with 0.25 ug Anti-Human CD336 Rabbit RecAb (98371-1-RR, Clone:242228B9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98371-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98371-1-RR (same clone as 98371-1-PBS)

  1x10^6 HEK-293T cells or CD336 Transfected HEK-293T cells were stained with 0.25 ug Anti-Human CD336 Rabbit RecAb (98371-1-RR, Clone:242228B9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98371-1-PBS in a different storage buffer formulation.

CD336 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98371-1-PBS

Clone No.242228B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

NCR2, LY95, Lymphocyte antigen 95 homolog, Natural killer cell p44-related protein, NK cell activating receptor

---

Product Information

98371-1-PBS targets CD336 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1594

  Product name: Recombinant Human CD336 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-190 aa of NM_004828

  Sequence: QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

• Full Name: natural cytotoxicity triggering receptor 2
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_004828
• Gene Symbol: CD336
• Gene ID (NCBI): 9436
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95944
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD336, also named as NCR2, LY95 and NKp44, belongs to the natural cytotoxicity receptor (NCR) family. It is cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. It is expressed on activated human NK cells. CD336 displays a single extracellular Ig-like V domain and a transmembrane portion containing the charged residue (Lysine), likely involved in the association with KARAP/DAP12 molecules. The antibody is specific to CD336.