Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human colon tissue, human liver tissue, human thymus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:450-1:1800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 41 publications below |
| IF | See 46 publications below |
| ELISA | See 1 publications below |
Product Information
67786-1-Ig targets CD4 in IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30870 Product name: Recombinant human CD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-226 aa of BC025782 Sequence: KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLA Predict reactive species |
| Full Name | CD4 molecule |
| Calculated Molecular Weight | 55 kDa |
| GenBank Accession Number | BC025782 |
| Gene Symbol | CD4 |
| Gene ID (NCBI) | 920 |
| ENSEMBL Gene ID | ENSG00000010610 |
| RRID | AB_2918550 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01730 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells (PMID: 9304802; 12213222). CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation (PMID: 9539765; 3112582). CD4 serves as a receptor for the human immunodeficiency virus (HIV) (PMID: 9304802).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD4 antibody 67786-1-Ig | Download protocol |
| IHC protocol for CD4 antibody 67786-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Mol Immunol Sexual dimorphism of lung immune-regulatory units imprint biased pulmonary fibrosis | ||
Cancer Commun (Lond) Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies | ||
J Med Virol Combination of novel oncolytic herpesvirus with paclitaxel as an efficient strategy for breast cancer therapy | ||
Cardiovasc Res Inhibition of PGK1 attenuates autoimmune myocarditis by reprogramming CD4+ T cells metabolism | ||
Clin Transl Med Single-cell transcriptome sequencing of B-cell heterogeneity and tertiary lymphoid structure predicts breast cancer prognosis and neoadjuvant therapy efficacy | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Emma (Verified Customer) (11-29-2021) | Used for IF on FFPE prostate tissue. Antigen retrieval Tris-EDTA pH 9.0.
|

















