Tested Applications
Positive FC detected in | human PBMCs |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in 100 μl suspension |
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
FITC-98131 targets CD47 in FC applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg31499 Product name: Recombinant Human CD47 protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 19-139 aa of BC010016 Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVCVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP Predict reactive species |
Full Name | CD47 molecule |
Calculated Molecular Weight | 323 aa, 35 kDa |
GenBank Accession Number | BC010016 |
Gene Symbol | CD47 |
Gene ID (NCBI) | 961 |
Conjugate | FITC Plus Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 495 nm / 524 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q08722 |
Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.
Protocols
Product Specific Protocols | |
---|---|
FC protocol for FITC Plus CD47 antibody FITC-98131 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |