Rat CD59 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of rat lung using 87072-1-RR (same clone as 87072-1-PBS)

  rat lung tissue was subjected to SDS PAGE followed by western blot with 87072-1-RR (CD59 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87072-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 87072-1-RR (same clone as 87072-1-PBS)

  rat heart tissue was subjected to SDS PAGE followed by western blot with 87072-1-RR (CD59 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87072-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 87072-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87072-1-RR against Rat CD59 were performed. The affinity constant is 4.24 nM.

CD59 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87072-1-PBS

Clone No.252160A2

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, Indirect ELISA

Synonyms

CD59 glycoprotein, MACIF, MAC-inhibitory protein, MAC-IP, Membrane attack complex inhibition factor

---

Product Information

87072-1-PBS targets CD59 in WB, Indirect ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3220

  Product name: Recombinant Rat CD59 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-101 aa of

  Sequence: NCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPNN

• Full Name: CD59 molecule, complement regulatory protein
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 18-20 kDa
• Gene Symbol: Cd59
• Gene ID (NCBI): 25407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27274
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.