CD59 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD59 Recombinant monoclonal antibody (87072-1-RR)

• 

  WB analysis of rat lung using 87072-1-RR

  rat lung tissue was subjected to SDS PAGE followed by western blot with 87072-1-RR (CD59 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 87072-1-RR

  rat heart tissue was subjected to SDS PAGE followed by western blot with 87072-1-RR (CD59 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 87072-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87072-1-RR against Rat CD59 were performed. The affinity constant is 4.24 nM.

CD59 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87072-1-RR

Clone No.252160A2

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, ELISA

Synonyms

CD59 glycoprotein, MACIF, MAC-inhibitory protein, MAC-IP, Membrane attack complex inhibition factor

---

Tested Applications

• Positive WB detected in: rat lung tissue, rat heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87072-1-RR targets CD59 in WB, ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3220

  Product name: Recombinant Rat CD59 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-101 aa of

  Sequence: NCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPNN

• Full Name: CD59 molecule, complement regulatory protein
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 18-20 kDa
• Gene Symbol: Cd59
• Gene ID (NCBI): 25407
• RRID: AB_3745316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27274
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.