• Featured Product
  • KD/KO Validated

CD61 / Integrin beta 3 Monoclonal antibody, PBS Only

CD61 / Integrin beta 3 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66952-1-PBS
Clone No.3D8E5

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

CD61, GP3A, GPIIIa, Integrin beta 3, ITGB3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66952-1-PBS targets CD61 / Integrin beta 3 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27834

Product name: Recombinant human ITGB3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 634-718 aa of BC127666

Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD

Predict reactive species
Full Name integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
Calculated Molecular Weight 788 aa, 87 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC127666
Gene Symbol Integrin beta 3
Gene ID (NCBI) 3690
RRIDAB_2882275
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05106
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Integrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa.

Loading...
||
New chat Able
正在加载,请稍候...