CD61 / Integrin beta 3 Monoclonal antibody, PBS Only

• 

  WB analysis of HUVEC using 66952-1-Ig (same clone as 66952-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 66952-1-Ig (CD61 / Integrin Beta 3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66952-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 66952-1-Ig (same clone as 66952-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 66952-1-Ig (CD61 / Integrin Beta 3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66952-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 66952-1-Ig (same clone as 66952-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66952-1-Ig (CD61 / Integrin Beta 3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66952-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 66952-1-Ig (same clone as 66952-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66952-1-Ig (CD61 / Integrin Beta 3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66952-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CD61 / Integrin beta 3 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66952-1-PBS

Clone No.3D8E5

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

CD61, GP3A, GPIIIa, Integrin beta 3, ITGB3

---

Product Information

66952-1-PBS targets CD61 / Integrin beta 3 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27834

  Product name: Recombinant human ITGB3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 634-718 aa of BC127666

  Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD

• Full Name: integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
• Calculated Molecular Weight: 788 aa, 87 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC127666
• Gene Symbol: Integrin beta 3
• Gene ID (NCBI): 3690
• RRID: AB_2882275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05106
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Integrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa.